PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00401
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NF-YB
Protein Properties Length: 225aa    MW: 24395.1 Da    PI: 6.005
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00401genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB170.61.8e-5333128297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 reqd+++Pianv+rim+++lPa+akis+daket+qecvse+isfvt+ea+++cqre+rkti+++d+lwa+++lGf+dyv+pl++++++yre+e+++
  AA39G00401  33 REQDQYMPIANVIRIMRRILPAHAKISDDAKETIQECVSEYISFVTGEANERCQREQRKTITAEDVLWAMGKLGFDDYVDPLTLFINRYREFESDR 128
                 89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.6E-4628128IPR009072Histone-fold
SuperFamilySSF471136.06E-3635129IPR009072Histone-fold
PfamPF008082.3E-2538102IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.9E-156684No hitNo description
PROSITE patternPS0068506985IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.9E-1585103No hitNo description
PRINTSPR006154.9E-15104122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045723Biological Processpositive regulation of fatty acid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MDQQNNPSSS TMVTTNNNNK TTPLVQPQPC AAREQDQYMP IANVIRIMRR ILPAHAKISD  60
DAKETIQECV SEYISFVTGE ANERCQREQR KTITAEDVLW AMGKLGFDDY VDPLTLFINR  120
YREFESDRGC SLRGDSGFKP GFAGVGIGLH GPLHGPSNGV VHGSGLAGPY GYGVFDQSVM  180
MNGGRFYPNG SGQDGFPNHG APGGSSSNSM SGMPGFDPYG QYKQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A2e-3833123494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-3833123494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A2e-3833123393NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002862657.11e-93hypothetical protein ARALYDRAFT_497363
SwissprotQ9SFD83e-92NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLD7MX192e-93D7MX19_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.264__1__AT1G21970.15e-93(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80422640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.14e-86NF-YB family protein